Sermorelin 86168-78-7 Skype davidyang1991913

Click image to view original image
Brand: Nanjian
型号: 86168-78-7
规格: 86168-78-7
Price: Negotiable
Min.Order: 1 1g
Supply 1 1g
Delivery: Shipment within 1 days since the date of payment
Address: China
Valid until: Never Expire
Updated on: 2015-10-30 14:02
Hits: 1462471
Enquiry
Company Detail
 
 
Details
Sermorelin 86168-78-7 Skype davidyang1991913

Product Name:

Sermorelin

Synonyms:

SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN)

CAS:

86168-78-7

MF:

C149H246N44O42S

MW:

3357.88

EINECS:

 

Product Categories:

Amino Acid Derivatives;Peptide;GH-RHObesity Research;GH-RHPeptides for Cell Biology;Growth Hormone Releasing Factors;Neuropeptides;Neurotransmission (Obesity);Releasing Factors

storage temp. 

−20°C

CAS DataBase Reference

86168-78-7(CAS DataBase Reference)

Usage

xanthine oxidase inhibitor




Product list:
1 Testosterone enanthate CAS: 315-37-7
2 Testosterone acetate CAS: 1045-69-8
3 Testosterone propionate  CAS: 57-85-2
5 Testosterone cypionate CAS: 58-20-8
6 Testosterone phenylpropionate CAS: 1255-49-8
7 Testosterone isocaproate  CAS: 15262-86-9
8 Testosterone decanoate  CAS: 5721-91-5
9 Testosterone Sustanon 250
10 Testosterone undecanoate CAS: 5949-44-0
11 Turinabol (4-Chlorotestosterone acetate)        CAS:  855-19-6
12 Oral turinabol  CAS: 2446-23-3
13 Stanolone (androstanolone) CAS: 521-18-6
14 Nandrolone Decanoate (DECA) CAS: 360-70-3
15 Nandrolone Cypionate  CAS: 601-63-8
16 Nandrolone Phenypropionate (Durabolin) CAS: 62-90-8
17 Boldenone Undecylenate (Equipoise)  CAS: 13103-34-9
18 Boldenone Acetate CAS :2363-59-9
19 Drostanolone Propionate (Masteron)  CAS: 521-12-0
20 Drostanolone Enanthate  CAS: 472-61-1
21 Superdrol Powder (methyl-drostanolone) CAS: 3381-88-2
22 Trenbolone Acetate (Finaplix H/Revalor-H)  CAS: 10161-34-9
23 Trenbolone Enanthate (parabolan)  CAS: 10161-33-8
24 Trenbolone Hexahydrobenzyl Carbonate CAS: 23454-33-3
25 Epiandrosterone  CAS: 481-29-8
26 Dehydroisoandrosterone Acetate CAS: 853-23-6
27 7-keto DHEA (7-oxo DHEA) CAS: 566-19-8
28 Methenolone Enanthate (Primobolan) CAS: 303-42-4
29 Methenolone Acetate  CAS: 434-05-9
30 Methandrostenolone(Dianabol)  CAS: 72-63-9
31 Tamoxifen Citrate (Nolvadex)  CAS: 54965-24-1
32 Clomiphene citrate  CAS: 50-41-9
33 Toremifene citrate  CAS: 89778-27-8
34 Letrazole(Femara) CAS: 112809-51-5
35 vardenafil  CAS: 831217-01-7
36 Dapoxetine  CAS: 119356-77-3
37 Dapoxetine HCl  CAS: 1071929-03-7
38 Dutasteride  CAS: 164656-23-9
39 Finasteride  CAS: 98319-26-7
40 Yohimbine HCl  CAS: 65-19-0
Hi friend!

  Specification  
T-A001 MGF 2mg  
T-A002 PEG MGF 2mg  
T-A003 CJC-1295 with DAC 2mg  
T-A004 CJC-1295 without DAC 2mg  
T-A005 PT-141 10mg  
T-A006 MT-1 10mg  
T-A007 MT-2 10mg  
T-A008 GHRP-2 5mg  
T-A008 GHRP-2 10mg  
T-A009 GHRP-6 5mg  
T-A009 GHRP-6 10mg  
T-A010 Ipamorelin 2mg  
T-A011 Hexarelin 2mg  
T-A012 Sermorelin 2mg  
T-A013 Oxytocin 2mg  
T-A014 TB500 2mg  
T-A015 pentadecapeptide BPC 157 2mg  
T-A016 GH 176-191 2mg  
T-A017 Triptorelin 2mg  
T-A018 Tesamorelin 2mg  
T-A020 Gonadorelin 2mg  
T-A020 Gonadorelin 10mg  
T-A021 DSIP 2mg  
T-A022 Selank 5mg
I am David from China.
Our company is a professional and skilled manufacturer in China in pharmaceutical area for years.Our products have exported to USA ,Greece ,Spain ,UK,Germany ,Australia and other  countries ,and we have got very good feedback from our customers .
High quality,best price,first-class service,high successful delivery rate,plenty of stock guarantee faster delivery after payment.
What are you waiting for ? More details contact me freely.
All kinds steroids and polypeptide series pharmaceutical raw materials.local anesthesia. FROM CHINA
davidyang@ycphar.com 
Skype:davidyang1991913
whatsapp 008618578209879
http://www.newlysteroid.com/
Total: 0 [Show All]  Related Reviews
 
More »Our Others Products

[ ProductsSearch ]  [ Add To Favourite ]  [ Tell Friends ]  [ Print Content ]  [ Violation Report ]  [ Close Window ]